PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo7G0022000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 227aa    MW: 24614.4 Da    PI: 8.6527
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo7G0022000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-38463362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++l+cprC s+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Spipo7G0022000  4 MQILRCPRCYSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRAK 63
                    57899****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-25157IPR003851Zinc finger, Dof-type
PfamPF027016.4E-33661IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.189761IPR003851Zinc finger, Dof-type
PROSITE patternPS013610945IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MENMQILRCP RCYSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCRKNK  60
RAKKPASSAS NSPPAAPVFP SANSTSRHSH LSSPSVSELF YGNPADAAQL SFPTGSSFEG  120
EDYGIQRQTA VDTTPSLTDL LAENSFTASN PYLSLYTTFQ AQMGSGNSTS LTNIKSERMT  180
TISGHDHCFN WPLAPHQSTP EATLEIEPSL YWNTLAAAGF GGGTLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025580.12e-42F-box family protein, putative
RefseqXP_012091631.11e-42PREDICTED: dof zinc finger protein DOF1.4 isoform X2
TrEMBLA0A061GGE92e-42A0A061GGE9_THECC; F-box family protein, putative
TrEMBLF6HM252e-42F6HM25_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g00040.t015e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.18e-31Dof family protein